Anti PHKA2 pAb (ATL-HPA002912)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002912-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PHKA2
Alternative Gene Name: PHK, PYK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031295: 79%, ENSRNOG00000003063: 36%
Entrez Gene ID: 5256
Uniprot ID: P46019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPTKVLSAHRKS |
| Gene Sequence | GARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPTKVLSAHRKS |
| Gene ID - Mouse | ENSMUSG00000031295 |
| Gene ID - Rat | ENSRNOG00000003063 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHKA2 pAb (ATL-HPA002912) | |
| Datasheet | Anti PHKA2 pAb (ATL-HPA002912) Datasheet (External Link) |
| Vendor Page | Anti PHKA2 pAb (ATL-HPA002912) at Atlas Antibodies |
| Documents & Links for Anti PHKA2 pAb (ATL-HPA002912) | |
| Datasheet | Anti PHKA2 pAb (ATL-HPA002912) Datasheet (External Link) |
| Vendor Page | Anti PHKA2 pAb (ATL-HPA002912) |