Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024031-25

Protein Description: phosphoglycerate dehydrogenase
Gene Name: PHGDH
Alternative Gene Name: PDG, PGDH, SERA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053398: 100%, ENSRNOG00000019328: 98%
Entrez Gene ID: 26227
Uniprot ID: O43175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT
• Gene Sequence: KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT
• Gene ID - Mouse: ENSMUSG00000053398
• Gene ID - Rat: ENSRNOG00000019328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) – 1 Found

Gromova, Irina; Gromov, Pavel; Honma, Naoko; Kumar, Sudha; Rimm, David; Talman, Maj-Lis Møller; Wielenga, Vera Timmermans; Moreira, José M A. High level PHGDH expression in breast is predominantly associated with keratin 5-positive cell lineage independently of malignancy. Molecular Oncology. 2015;9(8):1636-54.