Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024031-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PHGDH
Alternative Gene Name: PDG, PGDH, SERA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053398: 100%, ENSRNOG00000019328: 98%
Entrez Gene ID: 26227
Uniprot ID: O43175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT |
| Gene Sequence | KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT |
| Gene ID - Mouse | ENSMUSG00000053398 |
| Gene ID - Rat | ENSRNOG00000019328 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) | |
| Datasheet | Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) | |
| Datasheet | Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) |
| Citations for Anti PHGDH pAb (ATL-HPA024031 w/enhanced validation) – 1 Found |
| Gromova, Irina; Gromov, Pavel; Honma, Naoko; Kumar, Sudha; Rimm, David; Talman, Maj-Lis Møller; Wielenga, Vera Timmermans; Moreira, José M A. High level PHGDH expression in breast is predominantly associated with keratin 5-positive cell lineage independently of malignancy. Molecular Oncology. 2015;9(8):1636-54. PubMed |