Anti PHACTR2 pAb (ATL-HPA031720)

Atlas Antibodies

Catalog No.:
ATL-HPA031720-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphatase and actin regulator 2
Gene Name: PHACTR2
Alternative Gene Name: C6orf56, KIAA0680
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062866: 76%, ENSRNOG00000015473: 71%
Entrez Gene ID: 9749
Uniprot ID: O75167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDG
Gene Sequence SALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDG
Gene ID - Mouse ENSMUSG00000062866
Gene ID - Rat ENSRNOG00000015473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHACTR2 pAb (ATL-HPA031720)
Datasheet Anti PHACTR2 pAb (ATL-HPA031720) Datasheet (External Link)
Vendor Page Anti PHACTR2 pAb (ATL-HPA031720) at Atlas Antibodies

Documents & Links for Anti PHACTR2 pAb (ATL-HPA031720)
Datasheet Anti PHACTR2 pAb (ATL-HPA031720) Datasheet (External Link)
Vendor Page Anti PHACTR2 pAb (ATL-HPA031720)