Anti PHACTR2 pAb (ATL-HPA031720)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031720-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PHACTR2
Alternative Gene Name: C6orf56, KIAA0680
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062866: 76%, ENSRNOG00000015473: 71%
Entrez Gene ID: 9749
Uniprot ID: O75167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDG |
| Gene Sequence | SALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDG |
| Gene ID - Mouse | ENSMUSG00000062866 |
| Gene ID - Rat | ENSRNOG00000015473 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHACTR2 pAb (ATL-HPA031720) | |
| Datasheet | Anti PHACTR2 pAb (ATL-HPA031720) Datasheet (External Link) |
| Vendor Page | Anti PHACTR2 pAb (ATL-HPA031720) at Atlas Antibodies |
| Documents & Links for Anti PHACTR2 pAb (ATL-HPA031720) | |
| Datasheet | Anti PHACTR2 pAb (ATL-HPA031720) Datasheet (External Link) |
| Vendor Page | Anti PHACTR2 pAb (ATL-HPA031720) |