Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041172-25

Protein Description: progesterone receptor membrane component 2
Gene Name: PGRMC2
Alternative Gene Name: DG6, PMBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049940: 53%, ENSRNOG00000014051: 50%
Entrez Gene ID: 10424
Uniprot ID: O15173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA
• Gene Sequence: RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA
• Gene ID - Mouse: ENSMUSG00000049940
• Gene ID - Rat: ENSRNOG00000014051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) – 1 Found

Jühlen, Ramona; Landgraf, Dana; Huebner, Angela; Koehler, Katrin. Identification of a novel putative interaction partner of the nucleoporin ALADIN. Biology Open. 2016;5(11):1697-1705.