Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041172-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PGRMC2
Alternative Gene Name: DG6, PMBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049940: 53%, ENSRNOG00000014051: 50%
Entrez Gene ID: 10424
Uniprot ID: O15173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Gene Sequence | RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Gene ID - Mouse | ENSMUSG00000049940 |
| Gene ID - Rat | ENSRNOG00000014051 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) | |
| Datasheet | Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) | |
| Datasheet | Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) |
| Citations for Anti PGRMC2 pAb (ATL-HPA041172 w/enhanced validation) – 1 Found |
| Jühlen, Ramona; Landgraf, Dana; Huebner, Angela; Koehler, Katrin. Identification of a novel putative interaction partner of the nucleoporin ALADIN. Biology Open. 2016;5(11):1697-1705. PubMed |