Anti PGBD4 pAb (ATL-HPA040896)

Atlas Antibodies

Catalog No.:
ATL-HPA040896-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: piggyBac transposable element derived 4
Gene Name: PGBD4
Alternative Gene Name: FLJ32638, FLJ37497
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096316: 21%, ENSRNOG00000016366: 19%
Entrez Gene ID: 161779
Uniprot ID: Q96DM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKR
Gene Sequence VLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKR
Gene ID - Mouse ENSMUSG00000096316
Gene ID - Rat ENSRNOG00000016366
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGBD4 pAb (ATL-HPA040896)
Datasheet Anti PGBD4 pAb (ATL-HPA040896) Datasheet (External Link)
Vendor Page Anti PGBD4 pAb (ATL-HPA040896) at Atlas Antibodies

Documents & Links for Anti PGBD4 pAb (ATL-HPA040896)
Datasheet Anti PGBD4 pAb (ATL-HPA040896) Datasheet (External Link)
Vendor Page Anti PGBD4 pAb (ATL-HPA040896)