Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035611-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: profilin 2
Gene Name: PFN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027805: 98%, ENSRNOG00000017427: 93%
Entrez Gene ID: 5217
Uniprot ID: P35080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD
Gene Sequence QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD
Gene ID - Mouse ENSMUSG00000027805
Gene ID - Rat ENSRNOG00000017427
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation)
Datasheet Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation)
Datasheet Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation)
Citations for Anti PFN2 pAb (ATL-HPA035611 w/enhanced validation) – 1 Found
Obinata, Daisuke; Funakoshi, Daigo; Takayama, Kenichi; Hara, Makoto; Niranjan, Birunthi; Teng, Linda; Lawrence, Mitchell G; Taylor, Renea A; Risbridger, Gail P; Suzuki, Yutaka; Takahashi, Satoru; Inoue, Satoshi. OCT1-target neural gene PFN2 promotes tumor growth in androgen receptor-negative prostate cancer. Scientific Reports. 2022;12(1):6094.  PubMed