Anti PEX3 pAb (ATL-HPA042830)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042830-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PEX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019809: 97%, ENSRNOG00000015660: 97%
Entrez Gene ID: 8504
Uniprot ID: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ |
| Gene Sequence | LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ |
| Gene ID - Mouse | ENSMUSG00000019809 |
| Gene ID - Rat | ENSRNOG00000015660 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PEX3 pAb (ATL-HPA042830) | |
| Datasheet | Anti PEX3 pAb (ATL-HPA042830) Datasheet (External Link) |
| Vendor Page | Anti PEX3 pAb (ATL-HPA042830) at Atlas Antibodies |
| Documents & Links for Anti PEX3 pAb (ATL-HPA042830) | |
| Datasheet | Anti PEX3 pAb (ATL-HPA042830) Datasheet (External Link) |
| Vendor Page | Anti PEX3 pAb (ATL-HPA042830) |
| Citations for Anti PEX3 pAb (ATL-HPA042830) – 2 Found |
| Dahabieh, Michael S; Ha, ZongYi; Di Pietro, Erminia; Nichol, Jessica N; Bolt, Alicia M; Goncalves, Christophe; Dupéré-Richer, Daphné; Pettersson, Filippa; Mann, Koren K; Braverman, Nancy E; Del Rincón, Sonia V; Miller, Wilson H Jr. Peroxisomes protect lymphoma cells from HDAC inhibitor-mediated apoptosis. Cell Death And Differentiation. 2017;24(11):1912-1924. PubMed |
| Farelo, Mafalda A; Korrou-Karava, Despoina; Brooks, Katrina F; Russell, Tiffany A; Maringer, Kevin; Mayerhofer, Peter U. Dengue and Zika Virus Capsid Proteins Contain a Common PEX19-Binding Motif. Viruses. 2022;14(2) PubMed |