Anti PEX3 pAb (ATL-HPA042830)

Atlas Antibodies

Catalog No.:
ATL-HPA042830-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 3
Gene Name: PEX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019809: 97%, ENSRNOG00000015660: 97%
Entrez Gene ID: 8504
Uniprot ID: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
Gene Sequence LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
Gene ID - Mouse ENSMUSG00000019809
Gene ID - Rat ENSRNOG00000015660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEX3 pAb (ATL-HPA042830)
Datasheet Anti PEX3 pAb (ATL-HPA042830) Datasheet (External Link)
Vendor Page Anti PEX3 pAb (ATL-HPA042830) at Atlas Antibodies

Documents & Links for Anti PEX3 pAb (ATL-HPA042830)
Datasheet Anti PEX3 pAb (ATL-HPA042830) Datasheet (External Link)
Vendor Page Anti PEX3 pAb (ATL-HPA042830)
Citations for Anti PEX3 pAb (ATL-HPA042830) – 2 Found
Dahabieh, Michael S; Ha, ZongYi; Di Pietro, Erminia; Nichol, Jessica N; Bolt, Alicia M; Goncalves, Christophe; Dupéré-Richer, Daphné; Pettersson, Filippa; Mann, Koren K; Braverman, Nancy E; Del Rincón, Sonia V; Miller, Wilson H Jr. Peroxisomes protect lymphoma cells from HDAC inhibitor-mediated apoptosis. Cell Death And Differentiation. 2017;24(11):1912-1924.  PubMed
Farelo, Mafalda A; Korrou-Karava, Despoina; Brooks, Katrina F; Russell, Tiffany A; Maringer, Kevin; Mayerhofer, Peter U. Dengue and Zika Virus Capsid Proteins Contain a Common PEX19-Binding Motif. Viruses. 2022;14(2)  PubMed