Anti PEAR1 pAb (ATL-HPA035217)

Atlas Antibodies

Catalog No.:
ATL-HPA035217-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: platelet endothelial aggregation receptor 1
Gene Name: PEAR1
Alternative Gene Name: FLJ00193, JEDI, MEGF12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028073: 80%, ENSRNOG00000014243: 79%
Entrez Gene ID: 375033
Uniprot ID: Q5VY43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES
Gene Sequence PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES
Gene ID - Mouse ENSMUSG00000028073
Gene ID - Rat ENSRNOG00000014243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEAR1 pAb (ATL-HPA035217)
Datasheet Anti PEAR1 pAb (ATL-HPA035217) Datasheet (External Link)
Vendor Page Anti PEAR1 pAb (ATL-HPA035217) at Atlas Antibodies

Documents & Links for Anti PEAR1 pAb (ATL-HPA035217)
Datasheet Anti PEAR1 pAb (ATL-HPA035217) Datasheet (External Link)
Vendor Page Anti PEAR1 pAb (ATL-HPA035217)