Anti PEAR1 pAb (ATL-HPA035217)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035217-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PEAR1
Alternative Gene Name: FLJ00193, JEDI, MEGF12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028073: 80%, ENSRNOG00000014243: 79%
Entrez Gene ID: 375033
Uniprot ID: Q5VY43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES |
| Gene Sequence | PSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYES |
| Gene ID - Mouse | ENSMUSG00000028073 |
| Gene ID - Rat | ENSRNOG00000014243 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PEAR1 pAb (ATL-HPA035217) | |
| Datasheet | Anti PEAR1 pAb (ATL-HPA035217) Datasheet (External Link) |
| Vendor Page | Anti PEAR1 pAb (ATL-HPA035217) at Atlas Antibodies |
| Documents & Links for Anti PEAR1 pAb (ATL-HPA035217) | |
| Datasheet | Anti PEAR1 pAb (ATL-HPA035217) Datasheet (External Link) |
| Vendor Page | Anti PEAR1 pAb (ATL-HPA035217) |