Anti PDZRN3 pAb (ATL-HPA038822)

Atlas Antibodies

Catalog No.:
ATL-HPA038822-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: PDZ domain containing ring finger 3
Gene Name: PDZRN3
Alternative Gene Name: KIAA1095, LNX3, SEMACAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035357: 74%, ENSRNOG00000057556: 74%
Entrez Gene ID: 23024
Uniprot ID: Q9UPQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSP
Gene Sequence PDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSP
Gene ID - Mouse ENSMUSG00000035357
Gene ID - Rat ENSRNOG00000057556
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDZRN3 pAb (ATL-HPA038822)
Datasheet Anti PDZRN3 pAb (ATL-HPA038822) Datasheet (External Link)
Vendor Page Anti PDZRN3 pAb (ATL-HPA038822) at Atlas Antibodies

Documents & Links for Anti PDZRN3 pAb (ATL-HPA038822)
Datasheet Anti PDZRN3 pAb (ATL-HPA038822) Datasheet (External Link)
Vendor Page Anti PDZRN3 pAb (ATL-HPA038822)
Citations for Anti PDZRN3 pAb (ATL-HPA038822) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed