Anti PDS5B pAb (ATL-HPA039513)

Atlas Antibodies

Catalog No.:
ATL-HPA039513-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Gene Name: PDS5B
Alternative Gene Name: APRIN, AS3, CG008, FLJ23236, KIAA0979
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034021: 78%, ENSRNOG00000001098: 81%
Entrez Gene ID: 23047
Uniprot ID: Q9NTI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER
Gene Sequence ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER
Gene ID - Mouse ENSMUSG00000034021
Gene ID - Rat ENSRNOG00000001098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDS5B pAb (ATL-HPA039513)
Datasheet Anti PDS5B pAb (ATL-HPA039513) Datasheet (External Link)
Vendor Page Anti PDS5B pAb (ATL-HPA039513) at Atlas Antibodies

Documents & Links for Anti PDS5B pAb (ATL-HPA039513)
Datasheet Anti PDS5B pAb (ATL-HPA039513) Datasheet (External Link)
Vendor Page Anti PDS5B pAb (ATL-HPA039513)