Anti PDLIM1 pAb (ATL-HPA017010 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017010-100

Protein Description: PDZ and LIM domain 1
Gene Name: PDLIM1
Alternative Gene Name: CLIM1, CLP-36, CLP36, hCLIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055044: 94%, ENSRNOG00000016166: 94%
Entrez Gene ID: 9124
Uniprot ID: O00151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTV
• Gene Sequence: EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTV
• Gene ID - Mouse: ENSMUSG00000055044
• Gene ID - Rat: ENSRNOG00000016166
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDLIM1 pAb (ATL-HPA017010 w/enhanced validation) – 1 Found

Lu, Yixuan; Mu, Yongxin; Chen, Ju; Guan, Xinyuan; Guo, Ling; Wu, Chuanyue. CLP36 promotes p53 deficient sarcoma progression through suppression of atrophin-1 interacting protein-4 (AIP-4)-dependent degradation of YAP1. Theranostics. 12(11):5051-5068.