Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036912-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 8B
Gene Name: PDE8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021684: 94%, ENSRNOG00000010280: 93%
Entrez Gene ID: 8622
Uniprot ID: O95263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
Gene Sequence FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
Gene ID - Mouse ENSMUSG00000021684
Gene ID - Rat ENSRNOG00000010280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation)
Datasheet Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation)
Datasheet Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation)
Citations for Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation) – 1 Found
Campolo, Federica; Capponi, Chiara; Tarsitano, Maria Grazia; Tenuta, Marta; Pozza, Carlotta; Gianfrilli, Daniele; Magliocca, Fabio; Venneri, Mary A; Vicini, Elena; Lenzi, Andrea; Isidori, Andrea M; Barbagallo, Federica. cAMP-specific phosphodiesterase 8A and 8B isoforms are differentially expressed in human testis and Leydig cell tumor. Frontiers In Endocrinology. 13( 36277728):1010924.  PubMed