Anti PDE8B pAb (ATL-HPA036911)

Atlas Antibodies

Catalog No.:
ATL-HPA036911-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 8B
Gene Name: PDE8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021684: 99%, ENSRNOG00000010280: 62%
Entrez Gene ID: 8622
Uniprot ID: O95263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLD
Gene Sequence RRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLD
Gene ID - Mouse ENSMUSG00000021684
Gene ID - Rat ENSRNOG00000010280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE8B pAb (ATL-HPA036911)
Datasheet Anti PDE8B pAb (ATL-HPA036911) Datasheet (External Link)
Vendor Page Anti PDE8B pAb (ATL-HPA036911) at Atlas Antibodies

Documents & Links for Anti PDE8B pAb (ATL-HPA036911)
Datasheet Anti PDE8B pAb (ATL-HPA036911) Datasheet (External Link)
Vendor Page Anti PDE8B pAb (ATL-HPA036911)