Anti PDCL3 pAb (ATL-HPA018469 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018469-25

Protein Description: phosducin-like 3
Gene Name: PDCL3
Alternative Gene Name: VIAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026078: 84%, ENSRNOG00000013286: 84%
Entrez Gene ID: 79031
Uniprot ID: Q9H2J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
• Gene Sequence: IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
• Gene ID - Mouse: ENSMUSG00000026078
• Gene ID - Rat: ENSRNOG00000013286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.