Anti PDCL pAb (ATL-HPA021647)

Atlas Antibodies

Catalog No.:
ATL-HPA021647-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosducin-like
Gene Name: PDCL
Alternative Gene Name: DKFZp564M1863, PhLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009030: 89%, ENSRNOG00000008484: 88%
Entrez Gene ID: 5082
Uniprot ID: Q13371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQ
Gene Sequence EQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQ
Gene ID - Mouse ENSMUSG00000009030
Gene ID - Rat ENSRNOG00000008484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDCL pAb (ATL-HPA021647)
Datasheet Anti PDCL pAb (ATL-HPA021647) Datasheet (External Link)
Vendor Page Anti PDCL pAb (ATL-HPA021647) at Atlas Antibodies

Documents & Links for Anti PDCL pAb (ATL-HPA021647)
Datasheet Anti PDCL pAb (ATL-HPA021647) Datasheet (External Link)
Vendor Page Anti PDCL pAb (ATL-HPA021647)