Anti PDCL pAb (ATL-HPA021647)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021647-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PDCL
Alternative Gene Name: DKFZp564M1863, PhLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009030: 89%, ENSRNOG00000008484: 88%
Entrez Gene ID: 5082
Uniprot ID: Q13371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQ |
| Gene Sequence | EQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQ |
| Gene ID - Mouse | ENSMUSG00000009030 |
| Gene ID - Rat | ENSRNOG00000008484 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDCL pAb (ATL-HPA021647) | |
| Datasheet | Anti PDCL pAb (ATL-HPA021647) Datasheet (External Link) |
| Vendor Page | Anti PDCL pAb (ATL-HPA021647) at Atlas Antibodies |
| Documents & Links for Anti PDCL pAb (ATL-HPA021647) | |
| Datasheet | Anti PDCL pAb (ATL-HPA021647) Datasheet (External Link) |
| Vendor Page | Anti PDCL pAb (ATL-HPA021647) |