Anti PDCD2 pAb (ATL-HPA026713)

Atlas Antibodies

Catalog No.: ATL-HPA026713-25

Protein Description: programmed cell death 2
Gene Name: PDCD2
Alternative Gene Name: RP8, ZMYND7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014771: 94%, ENSRNOG00000001490: 91%
Entrez Gene ID: 5134
Uniprot ID: Q16342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP
• Gene Sequence: PEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP
• Gene ID - Mouse: ENSMUSG00000014771
• Gene ID - Rat: ENSRNOG00000001490
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.