Anti PCYOX1 pAb (ATL-HPA035193)

Atlas Antibodies

Catalog No.: ATL-HPA035193-25

Protein Description: prenylcysteine oxidase 1
Gene Name: PCYOX1
Alternative Gene Name: KIAA0908, PCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029998: 80%, ENSRNOG00000016704: 74%
Entrez Gene ID: 51449
Uniprot ID: Q9UHG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDS
• Gene Sequence: HDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDS
• Gene ID - Mouse: ENSMUSG00000029998
• Gene ID - Rat: ENSRNOG00000016704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCYOX1 pAb (ATL-HPA035193) – 1 Found

Banfi, C; Baetta, R; Barbieri, S S; Brioschi, M; Guarino, A; Ghilardi, S; Sandrini, L; Eligini, S; Polvani, G; Bergman, O; Eriksson, P; Tremoli, E. Prenylcysteine oxidase 1, an emerging player in atherosclerosis. Communications Biology. 2021;4(1):1109.