Anti PCSK6 pAb (ATL-HPA004774)

Atlas Antibodies

Catalog No.: ATL-HPA004774-25

Protein Description: proprotein convertase subtilisin/kexin type 6
Gene Name: PCSK6
Alternative Gene Name: PACE4, SPC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030513: 96%, ENSRNOG00000011526: 96%
Entrez Gene ID: 5046
Uniprot ID: P29122
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR
• Gene Sequence: RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR
• Gene ID - Mouse: ENSMUSG00000030513
• Gene ID - Rat: ENSRNOG00000011526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCSK6 pAb (ATL-HPA004774) – 1 Found

Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43.