Anti PCOLCE pAb (ATL-HPA042927 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042927-25

Protein Description: procollagen C-endopeptidase enhancer
Gene Name: PCOLCE
Alternative Gene Name: PCPE, PCPE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029718: 71%, ENSRNOG00000025001: 71%
Entrez Gene ID: 5118
Uniprot ID: Q15113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS
• Gene Sequence: PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS
• Gene ID - Mouse: ENSMUSG00000029718
• Gene ID - Rat: ENSRNOG00000025001
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.