Anti PCNX4 pAb (ATL-HPA003390)

Atlas Antibodies

Catalog No.: ATL-HPA003390-25

Protein Description: pecanex homolog 4 (Drosophila)
Gene Name: PCNX4
Alternative Gene Name: C14orf135, PCNXL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034501: 79%, ENSRNOG00000005568: 76%
Entrez Gene ID: 64430
Uniprot ID: Q63HM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV
• Gene Sequence: NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV
• Gene ID - Mouse: ENSMUSG00000034501
• Gene ID - Rat: ENSRNOG00000005568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.