Anti PCNX4 pAb (ATL-HPA003390)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003390-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PCNX4
Alternative Gene Name: C14orf135, PCNXL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034501: 79%, ENSRNOG00000005568: 76%
Entrez Gene ID: 64430
Uniprot ID: Q63HM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV |
| Gene Sequence | NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV |
| Gene ID - Mouse | ENSMUSG00000034501 |
| Gene ID - Rat | ENSRNOG00000005568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCNX4 pAb (ATL-HPA003390) | |
| Datasheet | Anti PCNX4 pAb (ATL-HPA003390) Datasheet (External Link) |
| Vendor Page | Anti PCNX4 pAb (ATL-HPA003390) at Atlas Antibodies |
| Documents & Links for Anti PCNX4 pAb (ATL-HPA003390) | |
| Datasheet | Anti PCNX4 pAb (ATL-HPA003390) Datasheet (External Link) |
| Vendor Page | Anti PCNX4 pAb (ATL-HPA003390) |