Anti PCMT1 pAb (ATL-HPA003239 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003239-25

Protein Description: protein-L-isoaspartate (D-aspartate) O-methyltransferase
Gene Name: PCMT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019795: 94%, ENSRNOG00000014330: 94%
Entrez Gene ID: 5110
Uniprot ID: P22061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
• Gene Sequence: AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
• Gene ID - Mouse: ENSMUSG00000019795
• Gene ID - Rat: ENSRNOG00000014330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCMT1 pAb (ATL-HPA003239 w/enhanced validation) – 2 Found

Liang, Feng; Shi, Ligen; Zheng, Jingwei; Chen, Sheng; Wang, Yangxin; Zhang, Jianmin. Neuroprotective Effects of CGP3466B on Apoptosis Are Modulated by Protein-L-isoaspartate (D-aspartate) O-methyltransferase/Mst1 Pathways after Traumatic Brain Injury in Rats. Scientific Reports. 2017;7(1):9201. 

Forsström, Björn; Axnäs, Barbara Bisławska; Stengele, Klaus-Peter; Bühler, Jochen; Albert, Thomas J; Richmond, Todd A; Hu, Francis Jingxin; Nilsson, Peter; Hudson, Elton P; Rockberg, Johan; Uhlen, Mathias. Proteome-wide epitope mapping of antibodies using ultra-dense peptide arrays. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1585-97.