Anti PCK1 pAb (ATL-HPA006507 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006507-25

Protein Description: phosphoenolpyruvate carboxykinase 1 (soluble)
Gene Name: PCK1
Alternative Gene Name: PEPCK-C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027513: 85%, ENSRNOG00000028616: 86%
Entrez Gene ID: 5105
Uniprot ID: P35558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPC
• Gene Sequence: PFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPC
• Gene ID - Mouse: ENSMUSG00000027513
• Gene ID - Rat: ENSRNOG00000028616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCK1 pAb (ATL-HPA006507 w/enhanced validation) – 3 Found

Gutteridge, Rosie Elizabeth Ann; Singh, Chandra K; Ndiaye, Mary Ann; Ahmad, Nihal. Targeted knockdown of polo-like kinase 1 alters metabolic regulation in melanoma. Cancer Letters. 2017;394( 28235541):13-21. 

Hasan, Nesrin M; Johnson, Kelli F; Yin, Jianyi; Baetz, Nicholas W; Fayad, Lea; Sherman, Vadim; Blutt, Sarah E; Estes, Mary K; Kumbhari, Vivek; Zachos, Nicholas C; Kovbasnjuk, Olga. Intestinal stem cell-derived enteroids from morbidly obese patients preserve obesity-related phenotypes: Elevated glucose absorption and gluconeogenesis. Molecular Metabolism. 2021;44( 33246140):101129. 

Selmi-Ruby, Samia; Marín-Sáez, Jesús; Fildier, Aurélie; Buleté, Audrey; Abdallah, Myriam; Garcia, Jessica; Deverchère, Julie; Spinner, Loïc; Giroud, Barbara; Ibanez, Sébastien; Granjon, Thierry; Bardel, Claire; Puisieux, Alain; Fervers, Béatrice; Vulliet, Emmanuelle; Payen, Léa; Vigneron, Arnaud M. In Vivo Characterization of the Toxicological Properties of DPhP, One of the Main Degradation Products of Aryl Phosphate Esters. Environmental Health Perspectives. 2020;128(12):127006.