Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036547-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protocadherin gamma subfamily A, 1
Gene Name: PCDHGA1
Alternative Gene Name: PCDH-GAMMA-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103144: 77%, ENSRNOG00000039463: 80%
Entrez Gene ID: 56114
Uniprot ID: Q9Y5H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKV
Gene Sequence TYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKV
Gene ID - Mouse ENSMUSG00000103144
Gene ID - Rat ENSRNOG00000039463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation)
Datasheet Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation)
Datasheet Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCDHGA1 pAb (ATL-HPA036547 w/enhanced validation)