Anti PCDHA8 pAb (ATL-HPA044585)

Atlas Antibodies

Catalog No.:
ATL-HPA044585-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protocadherin alpha 8
Gene Name: PCDHA8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102836: 34%, ENSRNOG00000050472: 35%
Entrez Gene ID: 56140
Uniprot ID: Q9Y5H6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCLPPDLGSVDVGEEQDLNVDHGLKVSPFKFRTHKFYLWKL
Gene Sequence PCLPPDLGSVDVGEEQDLNVDHGLKVSPFKFRTHKFYLWKL
Gene ID - Mouse ENSMUSG00000102836
Gene ID - Rat ENSRNOG00000050472
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHA8 pAb (ATL-HPA044585)
Datasheet Anti PCDHA8 pAb (ATL-HPA044585) Datasheet (External Link)
Vendor Page Anti PCDHA8 pAb (ATL-HPA044585) at Atlas Antibodies

Documents & Links for Anti PCDHA8 pAb (ATL-HPA044585)
Datasheet Anti PCDHA8 pAb (ATL-HPA044585) Datasheet (External Link)
Vendor Page Anti PCDHA8 pAb (ATL-HPA044585)