Anti PCDHA5 pAb (ATL-HPA044557)

Atlas Antibodies

Catalog No.: ATL-HPA044557-25

Protein Description: protocadherin alpha 5
Gene Name: PCDHA5
Alternative Gene Name: CNR6, CNRN6, CNRS6, CRNR6, PCDH-ALPHA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103092: 76%, ENSRNOG00000045960: 65%
Entrez Gene ID: 56143
Uniprot ID: Q9Y5H7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEIKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNTP
• Gene Sequence: GEIKVNGELDYEDYNSYEINIDAMDKSTFPLSGHCKVVVKLLDVNDNTP
• Gene ID - Mouse: ENSMUSG00000103092
• Gene ID - Rat: ENSRNOG00000045960
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.