Anti PCDHA3 pAb (ATL-HPA035667)

Atlas Antibodies

Catalog No.:
ATL-HPA035667-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protocadherin alpha 3
Gene Name: PCDHA3
Alternative Gene Name: PCDH-ALPHA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102312: 80%, ENSRNOG00000050378: 76%
Entrez Gene ID: 56145
Uniprot ID: Q9Y5H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAI
Gene Sequence LLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAI
Gene ID - Mouse ENSMUSG00000102312
Gene ID - Rat ENSRNOG00000050378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHA3 pAb (ATL-HPA035667)
Datasheet Anti PCDHA3 pAb (ATL-HPA035667) Datasheet (External Link)
Vendor Page Anti PCDHA3 pAb (ATL-HPA035667) at Atlas Antibodies

Documents & Links for Anti PCDHA3 pAb (ATL-HPA035667)
Datasheet Anti PCDHA3 pAb (ATL-HPA035667) Datasheet (External Link)
Vendor Page Anti PCDHA3 pAb (ATL-HPA035667)