Anti PCCB pAb (ATL-HPA036940 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036940-25

Protein Description: propionyl CoA carboxylase, beta polypeptide
Gene Name: PCCB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032527: 94%, ENSRNOG00000015869: 94%
Entrez Gene ID: 5096
Uniprot ID: P05166
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL
• Gene Sequence: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL
• Gene ID - Mouse: ENSMUSG00000032527
• Gene ID - Rat: ENSRNOG00000015869
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCCB pAb (ATL-HPA036940 w/enhanced validation) – 1 Found

Gomes, Ana P; Ilter, Didem; Low, Vivien; Drapela, Stanislav; Schild, Tanya; Mullarky, Edouard; Han, Julie; Elia, Ilaria; Broekaert, Dorien; Rosenzweig, Adam; Nagiec, Michal; Nunes, Joana B; Schaffer, Bethany E; Mutvei, Anders P; Asara, John M; Cantley, Lewis C; Fendt, Sarah-Maria; Blenis, John. Altered propionate metabolism contributes to tumour progression and aggressiveness. Nature Metabolism. 2022;4(4):435-443.