Anti PCBD1 pAb (ATL-HPA037575)

Atlas Antibodies

Catalog No.:
ATL-HPA037575-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
Gene Name: PCBD1
Alternative Gene Name: DCOH, PCBD, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020098: 98%, ENSRNOG00000000566: 100%
Entrez Gene ID: 5092
Uniprot ID: P61457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR
Gene Sequence MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR
Gene ID - Mouse ENSMUSG00000020098
Gene ID - Rat ENSRNOG00000000566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCBD1 pAb (ATL-HPA037575)
Datasheet Anti PCBD1 pAb (ATL-HPA037575) Datasheet (External Link)
Vendor Page Anti PCBD1 pAb (ATL-HPA037575) at Atlas Antibodies

Documents & Links for Anti PCBD1 pAb (ATL-HPA037575)
Datasheet Anti PCBD1 pAb (ATL-HPA037575) Datasheet (External Link)
Vendor Page Anti PCBD1 pAb (ATL-HPA037575)