Anti PCBD1 pAb (ATL-HPA037575)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037575-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PCBD1
Alternative Gene Name: DCOH, PCBD, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020098: 98%, ENSRNOG00000000566: 100%
Entrez Gene ID: 5092
Uniprot ID: P61457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR |
| Gene Sequence | MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR |
| Gene ID - Mouse | ENSMUSG00000020098 |
| Gene ID - Rat | ENSRNOG00000000566 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCBD1 pAb (ATL-HPA037575) | |
| Datasheet | Anti PCBD1 pAb (ATL-HPA037575) Datasheet (External Link) |
| Vendor Page | Anti PCBD1 pAb (ATL-HPA037575) at Atlas Antibodies |
| Documents & Links for Anti PCBD1 pAb (ATL-HPA037575) | |
| Datasheet | Anti PCBD1 pAb (ATL-HPA037575) Datasheet (External Link) |
| Vendor Page | Anti PCBD1 pAb (ATL-HPA037575) |