Anti PBX1 pAb (ATL-HPA003505 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003505-25

Protein Description: pre-B-cell leukemia homeobox 1
Gene Name: PBX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052534: 100%, ENSRNOG00000058096: 77%
Entrez Gene ID: 5087
Uniprot ID: P40424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV
• Gene Sequence: PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV
• Gene ID - Mouse: ENSMUSG00000052534
• Gene ID - Rat: ENSRNOG00000058096
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PBX1 pAb (ATL-HPA003505 w/enhanced validation) – 2 Found

Li, Jun; Xu, Jinshu; Jiang, Huihui; Zhang, Ting; Ramakrishnan, Aarthi; Shen, Li; Xu, Pin-Xian. Chromatin Remodelers Interact with Eya1 and Six2 to Target Enhancers to Control Nephron Progenitor Cell Maintenance. Journal Of The American Society Of Nephrology : Jasn. 2021;32(11):2815-2833. 

Mary, Laura; Leclerc, Delphine; Labalme, Audrey; Bellaud, Pascale; Mazaud-Guittot, Séverine; Dréano, Stéphane; Evrard, Bertrand; Bigand, Antoine; Cauchoix, Aurélie; Loget, Philippe; Lokchine, Anna; Cluzeau, Laurence; Gilot, David; Belaud-Rotureau, Marc-Antoine; Jaillard, Sylvie. Functional Assessment of a New PBX1 Variant in a 46,XY Fetus with Severe Syndromic Difference of Sexual Development through CRISPR-Cas9 Gene Editing. Genes. 2023;14(2)