Anti PBLD pAb (ATL-HPA038036 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038036-25

Protein Description: phenazine biosynthesis-like protein domain containing
Gene Name: PBLD
Alternative Gene Name: FLJ14767, MAWBP, MAWDBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000112129: 82%, ENSRNOG00000000386: 83%
Entrez Gene ID: 64081
Uniprot ID: P30039
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTE
• Gene Sequence: LSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTE
• Gene ID - Mouse: ENSMUSG00000112129
• Gene ID - Rat: ENSRNOG00000000386
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.