Anti PARPBP pAb (ATL-HPA039677)

Atlas Antibodies

Catalog No.: ATL-HPA039677-25

Protein Description: PARP1 binding protein
Gene Name: PARPBP
Alternative Gene Name: C12orf48, FLJ20641, PARI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035365: 58%, ENSRNOG00000004682: 53%
Entrez Gene ID: 55010
Uniprot ID: Q9NWS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RALTSNCENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVA
• Gene Sequence: RALTSNCENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVA
• Gene ID - Mouse: ENSMUSG00000035365
• Gene ID - Rat: ENSRNOG00000004682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.