Anti PAPD5 pAb (ATL-HPA042968)

Atlas Antibodies

Catalog No.: ATL-HPA042968-25

Protein Description: PAP associated domain containing 5
Gene Name: PAPD5
Alternative Gene Name: TRF4-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036779: 90%, ENSRNOG00000024212: 92%
Entrez Gene ID: 64282
Uniprot ID: Q8NDF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSH
• Gene Sequence: QSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSH
• Gene ID - Mouse: ENSMUSG00000036779
• Gene ID - Rat: ENSRNOG00000024212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAPD5 pAb (ATL-HPA042968) – 4 Found

Liu, Fei; Lee, Amy C H; Guo, Fang; Kondratowicz, Andrew S; Micolochick Steuer, Holly M; Miller, Angela; Bailey, Lauren D; Wang, Xiaohe; Chen, Shuai; Kultgen, Steven G; Cuconati, Andrea; Cole, Andrew G; Gotchev, Dimitar; Dorsey, Bruce D; Rijnbrand, Rene; Lam, Angela M; Sofia, Michael J; Gao, Min. Host Poly(A) Polymerases PAPD5 and PAPD7 Provide Two Layers of Protection That Ensure the Integrity and Stability of Hepatitis B Virus RNA. Journal Of Virology. 2021;95(18):e0057421. 

Roake, Caitlin M; Chen, Lu; Chakravarthy, Ananya L; Ferrell, James E Jr; Raffa, Grazia D; Artandi, Steven E. Disruption of Telomerase RNA Maturation Kinetics Precipitates Disease. Molecular Cell. 2019;74(4):688-700.e3. 

Nagpal, Neha; Tai, Albert K; Nandakumar, Jayakrishnan; Agarwal, Suneet. Domain specific mutations in dyskerin disrupt 3' end processing of scaRNA13. Nucleic Acids Research. 2022;50(16):9413-9425. 

Nagpal, Neha; Wang, Jianing; Zeng, Jing; Lo, Emily; Moon, Diane H; Luk, Kevin; Braun, Roman O; Burroughs, Lauri M; Keel, Sioban B; Reilly, Christopher; Lindsley, R Coleman; Wolfe, Scot A; Tai, Albert K; Cahan, Patrick; Bauer, Daniel E; Fong, Yick W; Agarwal, Suneet. Small-Molecule PAPD5 Inhibitors Restore Telomerase Activity in Patient Stem Cells. Cell Stem Cell. 2020;26(6):896-909.e8.