Anti PAIP2 pAb (ATL-HPA035945)

Atlas Antibodies

Catalog No.: ATL-HPA035945-25

Protein Description: poly(A) binding protein interacting protein 2
Gene Name: PAIP2
Alternative Gene Name: PAIP2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037058: 100%, ENSRNOG00000019934: 100%
Entrez Gene ID: 51247
Uniprot ID: Q9BPZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA
• Gene Sequence: IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA
• Gene ID - Mouse: ENSMUSG00000037058
• Gene ID - Rat: ENSRNOG00000019934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.