Anti PAICS pAb (ATL-HPA041538 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041538-25

Protein Description: phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Gene Name: PAICS
Alternative Gene Name: ADE2H1, AIRC, PAIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029247: 96%, ENSRNOG00000002101: 97%
Entrez Gene ID: 10606
Uniprot ID: P22234
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVA
• Gene Sequence: ERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVA
• Gene ID - Mouse: ENSMUSG00000029247
• Gene ID - Rat: ENSRNOG00000002101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.