Anti PACS1 pAb (ATL-HPA038914 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038914-25

Protein Description: phosphofurin acidic cluster sorting protein 1
Gene Name: PACS1
Alternative Gene Name: FLJ10209, KIAA1175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024855: 96%, ENSRNOG00000020350: 97%
Entrez Gene ID: 55690
Uniprot ID: Q6VY07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE
• Gene Sequence: DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE
• Gene ID - Mouse: ENSMUSG00000024855
• Gene ID - Rat: ENSRNOG00000020350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PACS1 pAb (ATL-HPA038914 w/enhanced validation) – 1 Found

Mani, Chinnadurai; Tripathi, Kaushlendra; Luan, Shan; Clark, David W; Andrews, Joel F; Vindigni, Alessandro; Thomas, Gary; Palle, Komaraiah. The multifunctional protein PACS-1 is required for HDAC2- and HDAC3-dependent chromatin maturation and genomic stability. Oncogene. 2020;39(12):2583-2596.