Anti PABPN1L pAb (ATL-HPA043415)

Atlas Antibodies

Catalog No.: ATL-HPA043415-25

Protein Description: poly(A) binding protein, nuclear 1-like (cytoplasmic)
Gene Name: PABPN1L
Alternative Gene Name: ePABP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069867: 57%, ENSRNOG00000029558: 65%
Entrez Gene ID: 390748
Uniprot ID: A6NDY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEE
• Gene Sequence: MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEE
• Gene ID - Mouse: ENSMUSG00000069867
• Gene ID - Rat: ENSRNOG00000029558
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.