Anti PABPC1L2A pAb (ATL-HPA041573)

Atlas Antibodies

Catalog No.: ATL-HPA041573-25

Protein Description: poly(A) binding protein, cytoplasmic 1-like 2A
Gene Name: PABPC1L2A
Alternative Gene Name: RBM32A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022283: 50%, ENSRNOG00000008639: 50%
Entrez Gene ID: 340529
Uniprot ID: Q5JQF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
• Gene Sequence: KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
• Gene ID - Mouse: ENSMUSG00000022283
• Gene ID - Rat: ENSRNOG00000008639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.