Anti PAAF1 pAb (ATL-HPA039952)

Atlas Antibodies

Catalog No.: ATL-HPA039952-25

Protein Description: proteasomal ATPase-associated factor 1
Gene Name: PAAF1
Alternative Gene Name: FLJ11848, Rpn14, WDR71
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022346: 20%, ENSRNOG00000011470: 22%
Entrez Gene ID: 80227
Uniprot ID: Q9BRP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
• Gene Sequence: GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
• Gene ID - Mouse: ENSMUSG00000022346
• Gene ID - Rat: ENSRNOG00000011470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.