Anti P2RX7 pAb (ATL-HPA042013)

Atlas Antibodies

Catalog No.: ATL-HPA042013-25

Protein Description: purinergic receptor P2X, ligand gated ion channel, 7
Gene Name: P2RX7
Alternative Gene Name: MGC20089, P2X7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029468: 60%, ENSRNOG00000001296: 57%
Entrez Gene ID: 5027
Uniprot ID: Q99572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ
• Gene Sequence: AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ
• Gene ID - Mouse: ENSMUSG00000029468
• Gene ID - Rat: ENSRNOG00000001296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti P2RX7 pAb (ATL-HPA042013) – 1 Found

Walenta, Lena; Fleck, David; Fröhlich, Thomas; von Eysmondt, Hendrik; Arnold, Georg J; Spehr, Jennifer; Schwarzer, J Ullrich; Köhn, Frank-Michael; Spehr, Marc; Mayerhofer, Artur. ATP-mediated Events in Peritubular Cells Contribute to Sterile Testicular Inflammation. Scientific Reports. 2018;8(1):1431.