Anti P2RX7 pAb (ATL-HPA042013)

Atlas Antibodies

Catalog No.:
ATL-HPA042013-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: purinergic receptor P2X, ligand gated ion channel, 7
Gene Name: P2RX7
Alternative Gene Name: MGC20089, P2X7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029468: 60%, ENSRNOG00000001296: 57%
Entrez Gene ID: 5027
Uniprot ID: Q99572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ
Gene Sequence AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ
Gene ID - Mouse ENSMUSG00000029468
Gene ID - Rat ENSRNOG00000001296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti P2RX7 pAb (ATL-HPA042013)
Datasheet Anti P2RX7 pAb (ATL-HPA042013) Datasheet (External Link)
Vendor Page Anti P2RX7 pAb (ATL-HPA042013) at Atlas Antibodies

Documents & Links for Anti P2RX7 pAb (ATL-HPA042013)
Datasheet Anti P2RX7 pAb (ATL-HPA042013) Datasheet (External Link)
Vendor Page Anti P2RX7 pAb (ATL-HPA042013)
Citations for Anti P2RX7 pAb (ATL-HPA042013) – 1 Found
Walenta, Lena; Fleck, David; Fröhlich, Thomas; von Eysmondt, Hendrik; Arnold, Georg J; Spehr, Jennifer; Schwarzer, J Ullrich; Köhn, Frank-Michael; Spehr, Marc; Mayerhofer, Artur. ATP-mediated Events in Peritubular Cells Contribute to Sterile Testicular Inflammation. Scientific Reports. 2018;8(1):1431.  PubMed