Anti P2RX6 pAb (ATL-HPA028777)

Atlas Antibodies

Catalog No.: ATL-HPA028777-25

Protein Description: purinergic receptor P2X, ligand-gated ion channel, 6
Gene Name: P2RX6
Alternative Gene Name: MGC129625, P2RXL1, P2X6, P2XM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022758: 94%, ENSRNOG00000001873: 91%
Entrez Gene ID: 9127
Uniprot ID: O15547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN
• Gene Sequence: VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN
• Gene ID - Mouse: ENSMUSG00000022758
• Gene ID - Rat: ENSRNOG00000001873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.