Anti P2RX6 pAb (ATL-HPA028776)

Atlas Antibodies

Catalog No.: ATL-HPA028776-25

Protein Description: purinergic receptor P2X, ligand-gated ion channel, 6
Gene Name: P2RX6
Alternative Gene Name: MGC129625, P2RXL1, P2X6, P2XM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028977: 34%, ENSRNOG00000013474: 32%
Entrez Gene ID: 9127
Uniprot ID: O15547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS
• Gene Sequence: HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS
• Gene ID - Mouse: ENSMUSG00000028977
• Gene ID - Rat: ENSRNOG00000013474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.