Anti P2RX6 pAb (ATL-HPA028776)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028776-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: P2RX6
Alternative Gene Name: MGC129625, P2RXL1, P2X6, P2XM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028977: 34%, ENSRNOG00000013474: 32%
Entrez Gene ID: 9127
Uniprot ID: O15547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS |
| Gene Sequence | HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS |
| Gene ID - Mouse | ENSMUSG00000028977 |
| Gene ID - Rat | ENSRNOG00000013474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti P2RX6 pAb (ATL-HPA028776) | |
| Datasheet | Anti P2RX6 pAb (ATL-HPA028776) Datasheet (External Link) |
| Vendor Page | Anti P2RX6 pAb (ATL-HPA028776) at Atlas Antibodies |
| Documents & Links for Anti P2RX6 pAb (ATL-HPA028776) | |
| Datasheet | Anti P2RX6 pAb (ATL-HPA028776) Datasheet (External Link) |
| Vendor Page | Anti P2RX6 pAb (ATL-HPA028776) |