Anti OTUD4 pAb (ATL-HPA036623)

Atlas Antibodies

Catalog No.:
ATL-HPA036623-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: OTU deubiquitinase 4
Gene Name: OTUD4
Alternative Gene Name: DUBA6, HSHIN1, KIAA1046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036990: 72%, ENSRNOG00000018477: 75%
Entrez Gene ID: 54726
Uniprot ID: Q01804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGSVSTVDEFPEARGEHVHSLPEASVSSKPDEGRTEQSSQTRKADTALASIPPVAEGKAHPPTQILNRERETVPVELEPKRTIQS
Gene Sequence CGSVSTVDEFPEARGEHVHSLPEASVSSKPDEGRTEQSSQTRKADTALASIPPVAEGKAHPPTQILNRERETVPVELEPKRTIQS
Gene ID - Mouse ENSMUSG00000036990
Gene ID - Rat ENSRNOG00000018477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OTUD4 pAb (ATL-HPA036623)
Datasheet Anti OTUD4 pAb (ATL-HPA036623) Datasheet (External Link)
Vendor Page Anti OTUD4 pAb (ATL-HPA036623) at Atlas Antibodies

Documents & Links for Anti OTUD4 pAb (ATL-HPA036623)
Datasheet Anti OTUD4 pAb (ATL-HPA036623) Datasheet (External Link)
Vendor Page Anti OTUD4 pAb (ATL-HPA036623)
Citations for Anti OTUD4 pAb (ATL-HPA036623) – 3 Found
Das, Richa; Schwintzer, Lukas; Vinopal, Stanislav; Aguado Roca, Eva; Sylvester, Marc; Oprisoreanu, Ana-Maria; Schoch, Susanne; Bradke, Frank; Broemer, Meike. New roles for the de-ubiquitylating enzyme OTUD4 in an RNA-protein network and RNA granules. Journal Of Cell Science. 2019;132(12)  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Di, Muping; Miao, Jingjing; Pan, Qiuzhong; Wu, Zonglong; Chen, Boyu; Wang, Muru; Zhao, Jingjing; Huang, Huageng; Bai, Jiewen; Wang, Qijing; Tang, Yan; Li, Yongqiang; He, Jia; Xiang, Tong; Weng, Desheng; Wang, Lin; Xia, Jianchuan; Zhao, Chong. OTUD4-mediated GSDME deubiquitination enhances radiosensitivity in nasopharyngeal carcinoma by inducing pyroptosis. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):328.  PubMed