Anti OTOL1 pAb (ATL-HPA041030)

Atlas Antibodies

Catalog No.:
ATL-HPA041030-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: otolin 1
Gene Name: OTOL1
Alternative Gene Name: C1QTNF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027788: 87%, ENSRNOG00000021186: 85%
Entrez Gene ID: 131149
Uniprot ID: A6NHN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSI
Gene Sequence SYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSI
Gene ID - Mouse ENSMUSG00000027788
Gene ID - Rat ENSRNOG00000021186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OTOL1 pAb (ATL-HPA041030)
Datasheet Anti OTOL1 pAb (ATL-HPA041030) Datasheet (External Link)
Vendor Page Anti OTOL1 pAb (ATL-HPA041030) at Atlas Antibodies

Documents & Links for Anti OTOL1 pAb (ATL-HPA041030)
Datasheet Anti OTOL1 pAb (ATL-HPA041030) Datasheet (External Link)
Vendor Page Anti OTOL1 pAb (ATL-HPA041030)