Anti OTC pAb (ATL-HPA000570 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000570-25

Protein Description: ornithine carbamoyltransferase
Gene Name: OTC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031173: 97%, ENSRNOG00000003370: 97%
Entrez Gene ID: 5009
Uniprot ID: P00480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLAR
• Gene Sequence: QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLAR
• Gene ID - Mouse: ENSMUSG00000031173
• Gene ID - Rat: ENSRNOG00000003370
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OTC pAb (ATL-HPA000570 w/enhanced validation) – 1 Found

Montes-Nieto, Rafael; Fuentes-Almagro, Carlos A; Bonilla-Valverde, Daniel; Prieto-Alamo, María-José; Jurado, Juan; Carrascal, Montserrat; Gómez-Ariza, José Luis; López-Barea, Juan; Pueyo, Carmen. Proteomics in free-living Mus spretus to monitor terrestrial ecosystems. Proteomics. 2007;7(23):4376-87.