Anti OSBPL5 pAb (ATL-HPA038712)

Atlas Antibodies

Catalog No.: ATL-HPA038712-25

Protein Description: oxysterol binding protein-like 5
Gene Name: OSBPL5
Alternative Gene Name: KIAA1534, ORP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037606: 76%, ENSRNOG00000020713: 78%
Entrez Gene ID: 114879
Uniprot ID: Q9H0X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLK
• Gene Sequence: FSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLK
• Gene ID - Mouse: ENSMUSG00000037606
• Gene ID - Rat: ENSRNOG00000020713
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OSBPL5 pAb (ATL-HPA038712) – 1 Found

Guyard, Valentin; Monteiro-Cardoso, Vera Filipa; Omrane, Mohyeddine; Sauvanet, Cécile; Houcine, Audrey; Boulogne, Claire; Ben Mbarek, Kalthoum; Vitale, Nicolas; Faklaris, Orestis; El Khallouki, Naima; Thiam, Abdou Rachid; Giordano, Francesca. ORP5 and ORP8 orchestrate lipid droplet biogenesis and maintenance at ER-mitochondria contact sites. The Journal Of Cell Biology. 2022;221(9)