Anti OSBPL3 pAb (ATL-HPA000691 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000691-25

Protein Description: oxysterol binding protein-like 3
Gene Name: OSBPL3
Alternative Gene Name: KIAA0704, ORP-3, ORP3, OSBP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029822: 87%, ENSRNOG00000010011: 87%
Entrez Gene ID: 26031
Uniprot ID: Q9H4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE
• Gene Sequence: TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE
• Gene ID - Mouse: ENSMUSG00000029822
• Gene ID - Rat: ENSRNOG00000010011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OSBPL3 pAb (ATL-HPA000691 w/enhanced validation) – 2 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. 

Hu, Qingjiang; Masuda, Takaaki; Koike, Kensuke; Sato, Kuniaki; Tobo, Taro; Kuramitsu, Shotaro; Kitagawa, Akihiro; Fujii, Atsushi; Noda, Miwa; Tsuruda, Yusuke; Otsu, Hajime; Kuroda, Yosuke; Ito, Shuhei; Oki, Eiji; Mimori, Koshi. Oxysterol binding protein-like 3 (OSBPL3) is a novel driver gene that promotes tumor growth in part through R-Ras/Akt signaling in gastric cancer. Scientific Reports. 2021;11(1):19178.