Anti OSBPL2 pAb (ATL-HPA041127)

Atlas Antibodies

Catalog No.:
ATL-HPA041127-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: oxysterol binding protein-like 2
Gene Name: OSBPL2
Alternative Gene Name: KIAA0772, ORP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039050: 84%, ENSRNOG00000057756: 85%
Entrez Gene ID: 9885
Uniprot ID: Q9H1P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRT
Gene Sequence MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRT
Gene ID - Mouse ENSMUSG00000039050
Gene ID - Rat ENSRNOG00000057756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OSBPL2 pAb (ATL-HPA041127)
Datasheet Anti OSBPL2 pAb (ATL-HPA041127) Datasheet (External Link)
Vendor Page Anti OSBPL2 pAb (ATL-HPA041127) at Atlas Antibodies

Documents & Links for Anti OSBPL2 pAb (ATL-HPA041127)
Datasheet Anti OSBPL2 pAb (ATL-HPA041127) Datasheet (External Link)
Vendor Page Anti OSBPL2 pAb (ATL-HPA041127)