Anti OSBPL1A pAb (ATL-HPA040959)

Atlas Antibodies

Catalog No.:
ATL-HPA040959-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: oxysterol binding protein-like 1A
Gene Name: OSBPL1A
Alternative Gene Name: ORP-1, ORP1, OSBPL1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044252: 83%, ENSRNOG00000054058: 82%
Entrez Gene ID: 114876
Uniprot ID: Q9BXW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA
Gene Sequence VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA
Gene ID - Mouse ENSMUSG00000044252
Gene ID - Rat ENSRNOG00000054058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OSBPL1A pAb (ATL-HPA040959)
Datasheet Anti OSBPL1A pAb (ATL-HPA040959) Datasheet (External Link)
Vendor Page Anti OSBPL1A pAb (ATL-HPA040959) at Atlas Antibodies

Documents & Links for Anti OSBPL1A pAb (ATL-HPA040959)
Datasheet Anti OSBPL1A pAb (ATL-HPA040959) Datasheet (External Link)
Vendor Page Anti OSBPL1A pAb (ATL-HPA040959)