Anti OS9 pAb (ATL-HPA013694)

Atlas Antibodies

Catalog No.: ATL-HPA013694-25

Protein Description: osteosarcoma amplified 9, endoplasmic reticulum lectin
Gene Name: OS9
Alternative Gene Name: ERLEC2, OS-9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040462: 66%, ENSRNOG00000025570: 70%
Entrez Gene ID: 10956
Uniprot ID: Q13438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML
• Gene Sequence: PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML
• Gene ID - Mouse: ENSMUSG00000040462
• Gene ID - Rat: ENSRNOG00000025570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.