Anti OR2AE1 pAb (ATL-HPA042957)

Atlas Antibodies

Catalog No.: ATL-HPA042957-25

Protein Description: olfactory receptor, family 2, subfamily AE, member 1
Gene Name: OR2AE1
Alternative Gene Name: OR2AE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064252: 58%, ENSRNOG00000050694: 64%
Entrez Gene ID: 81392
Uniprot ID: Q8NHA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MHFPFCGPRKVYHFYCEFPAVVKLVCGDITVYETTV
• Gene Sequence: MHFPFCGPRKVYHFYCEFPAVVKLVCGDITVYETTV
• Gene ID - Mouse: ENSMUSG00000064252
• Gene ID - Rat: ENSRNOG00000050694
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.